PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ49820.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family G2-like
Protein Properties Length: 560aa    MW: 56263.2 Da    PI: 6.8061
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ49820.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.81e-3250104155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 k rlrWtpeLH+rFv+ v+qLGG++kAtPk il+lm+v+gLt++h+kSHLQkYRl
  KXZ49820.1  50 KSRLRWTPELHNRFVSSVNQLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKYRL 104
                 68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.0147107IPR017930Myb domain
SuperFamilySSF466893.58E-1848107IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.6E-3149106IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-2450104IPR006447Myb domain, plants
PfamPF002499.9E-952103IPR001005SANT/Myb domain
PfamPF143791.2E-13211252IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MAPLLQPGVA GLHQAAFPDL GLGAAGLAPG LLPGHYLAHP QRAAAAGPAK SRLRWTPELH  60
NRFVSSVNQL GGPDKATPKG ILKLMGVDGL TIYHIKSHLQ KYRLNIRLPG EATQGDSADT  120
DASDGEGAVP SASLERTQSA VGCGGGGMGV PAGMGGAGGG GGGGATGGPA EPTVSINAGG  180
GAAAARAAMS RRPGTASGSS GSAPSATRRN LEEALLFQME LQKKLHEQLE SQRQLQLSLE  240
AHGRYIAILM EQEGLTGKLT ELSNPASGAG GGGADAGAGS AAAAAGPSSG GAGGHARRVS  300
SGLGPAAGTQ HQSTQQQQLH QPLEMRRTGS MDQRSAPAAG GRDRGARGGA GSPMLSPSGS  360
GGGAGLLQPP PPQRTPSVGL ARQRSNLAQQ AAAAGPGSGS GVTGGSGVSS LQEQQQQHMY  420
ERTGRLGSLP TRGSLPGPDP GSLPGAGSGL AFADPMHRQG QAMGLPQPQE RGLEPAGAVD  480
LHQAQEQQEQ EQLQAPDGGM GALGEFDFGD FTDFTEQQNL LGGGDLLGMP NVFDTAAAAM  540
QQQQHQQQLQ EGDEEGRRRG
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1744805e-49AF174480.1 Chlamydomonas reinhardtii phosphate starvation regulator protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002951273.16e-80phosphorus starvation response 1 protein, transcriptional regulator
TrEMBLA0A150GKD90.0A0A150GKD9_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1111645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.15e-27G2-like family protein